PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g34670.1.p
Common NameBRADI_2g34670, LOC100839195
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB_related
Protein Properties Length: 210aa    MW: 23536.1 Da    PI: 7.5496
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g34670.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.73.5e-152569147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                      r rWT+eE++++++a +++G + Wk+I + +  ++t  q++s+ qk+
  Bradi2g34670.1.p 25 RERWTAEEHDRFLHALNLFGRD-WKRIEALVA-TKTSVQIRSHAQKF 69
                      78******************77.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.64E-171974IPR009057Homeodomain-like
PROSITE profilePS5129417.162074IPR017930Myb domain
SMARTSM007171.5E-102472IPR001005SANT/Myb domain
TIGRFAMsTIGR015576.6E-172472IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.602.2E-82565IPR009057Homeodomain-like
PfamPF002495.0E-122568IPR001005SANT/Myb domain
CDDcd001674.35E-92770No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 210 aa     Download sequence    Send to blast
MQALSSASTI GRKKLRKPYT ITRPRERWTA EEHDRFLHAL NLFGRDWKRI EALVATKTSV  60
QIRSHAQKFF LKAHKFGLAA CLPPPLHPRR SAALLQQPQP DNIDMQVPSM EECHRPRASP  120
EYLCPDLDGA WLDQDGTPIA IELPLSPDDL RFAQVYRFVG DFFGADDATA AANVPVEARL  180
WCLLLQGMDP LVVDTILLVL SNLQANLFA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003566512.21e-154PREDICTED: protein REVEILLE 6-like
TrEMBLI1HLH31e-154I1HLH3_BRADI; Uncharacterized protein
STRINGBRADI2G34670.11e-153(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36423170
Representative plantOGRP12551549
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52660.11e-34MYB_related family protein